PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D04G0093
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 171aa    MW: 19814.4 Da    PI: 9.528
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D04G0093genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.24.3e-191259148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd +l+++++ +G ++W+tIa++ g++R++k+c++rw +yl
      Gh_D04G0093 12 KGAWTSEEDTKLAEVIAVHGAKSWNTIASKAGLKRCGKSCRLRWMNYL 59
                     79********************************************97 PP

2Myb_DNA-binding52.31.3e-1665110148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ +++E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
      Gh_D04G0093  65 RGNISEQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 110
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.742759IPR017930Myb domain
SuperFamilySSF466891.21E-299106IPR009057Homeodomain-like
SMARTSM007172.1E-141161IPR001005SANT/Myb domain
PfamPF002491.2E-171259IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-241366IPR009057Homeodomain-like
CDDcd001671.57E-91459No hitNo description
PROSITE profilePS5129426.06660114IPR017930Myb domain
SMARTSM007177.1E-1664112IPR001005SANT/Myb domain
PfamPF002493.7E-1565110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2567115IPR009057Homeodomain-like
CDDcd001675.75E-1069110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MGVKKERPQI NKGAWTSEED TKLAEVIAVH GAKSWNTIAS KAGLKRCGKS CRLRWMNYLR  60
PNIKRGNISE QEEDLILRLH KLLGNRWSLI AGRLPGRTDN EIKNYWNSHL SKKIKQKEKQ  120
GCKDEKRSVE NGKEELRQEN TCAAGGEDSN ISFDVDEFFD FSDEKFEWMN R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-3181143108B-MYB
1h8a_C1e-30811423128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.80871e-124boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0341311e-116AF034131.1 Gossypium hirsutum MYB-like DNA-binding domain protein (MYB3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461068.11e-121PREDICTED: transcription factor MYB114-like
SwissprotQ9SEI06e-56WER_ARATH; Transcription factor WER
TrEMBLA0A0D2V0911e-121A0A0D2V091_G
STRINGPOPTR_0001s16970.17e-77(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.17e-54myb domain protein 66